SCOPe 2.05: Domain d1w6ka2: 1w6k A:100-378

Lineage for d1w6ka2 (1w6k A:100-378)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.2: Terpene synthases [48243] (2 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Lanosterol synthase [116989] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116990] (2 PDB entries)
   Uniprot P48449

8. Domain d1w6ka2: 1w6k A:100-378 [114272]
   complexed with bog, lan

Details for d1w6ka2

PDB Entry: 1w6k, 2.1 Å

PDB Description: structure of human osc in complex with lanosterol

PDB Compounds: (A:) lanosterol synthase

SCOPe Domain Sequences for d1w6ka2:

Sequence; same for both SEQRES and ATOM records:

>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]}
gplfllpgllitchvariplpagyreeivrylrsvqlpdggwglhiedkstvfgtalnyv
slrilgvgpddpdlvrarnilhkkggavaipswgkfwlavlnvysweglntlfpemwlfp
dwapahpstlwchcrqvylpmsycyavrlsaaedplvqslrqelyvedfasidwlaqrnn
vapdelytphswllrvvyallnlyehhhsahlrqravqklyehivaddrftksisigpis
ktinmlvrwyvdgpastafqehvsripdylwmgldgmkm

Timeline for d1w6ka2:

• d1w6ka2 first appeared in SCOP 1.71
  
• d1w6ka2 appears in SCOPe 2.04
  
• d1w6ka2 appears in SCOPe 2.06
  
• d1w6ka2 appears in the current release, SCOPe 2.08