Lineage for d1w6ka2 (1w6k A:100-378)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) 
Family a.102.4.2: Terpene synthases [48243] (3 proteins)
consists of two toroid domains: one of six and one of five hairpins- Protein Lanosterol synthase, middle domain [418899] (1 species)
- Species Human (Homo sapiens) [TaxId:9606] [419299] (2 PDB entries)
Uniprot P48449 
Domain d1w6ka2: 1w6k A:100-378 [114272]
Other proteins in same PDB: d1w6ka1
complexed with bog, lan
Details for d1w6ka2
PDB Entry: 1w6k (more details), 2.1 Å
PDB Description: structure of human osc in complex with lanosterol
PDB Compounds: (A:) lanosterol synthaseSCOPe Domain Sequences for d1w6ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase, middle domain {Human (Homo sapiens) [TaxId: 9606]}
gplfllpgllitchvariplpagyreeivrylrsvqlpdggwglhiedkstvfgtalnyv
slrilgvgpddpdlvrarnilhkkggavaipswgkfwlavlnvysweglntlfpemwlfp
dwapahpstlwchcrqvylpmsycyavrlsaaedplvqslrqelyvedfasidwlaqrnn
vapdelytphswllrvvyallnlyehhhsahlrqravqklyehivaddrftksisigpis
ktinmlvrwyvdgpastafqehvsripdylwmgldgmkm
SCOPe Domain Coordinates for d1w6ka2:
Click to download the PDB-style file with coordinates for d1w6ka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w6ka2:
- d1w6ka2 first appeared in SCOP 1.71
- d1w6ka2 appears in SCOPe 2.07
View in 3D
