Lineage for d1w6ka2 (1w6k A:100-378)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. Family a.102.4.2: Terpene synthases [48243] (3 proteins)
    consists of two toroid domains: one of six and one of five hairpins
  6. Protein Lanosterol synthase, middle domain [418899] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [419299] (2 PDB entries)
    Uniprot P48449
  8. Domain d1w6ka2: 1w6k A:100-378 [114272]
    Other proteins in same PDB: d1w6ka1
    complexed with bog, lan

Details for d1w6ka2

PDB Entry: 1w6k (more details), 2.1 Å

PDB Description: structure of human osc in complex with lanosterol
PDB Compounds: (A:) lanosterol synthase

SCOPe Domain Sequences for d1w6ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase, middle domain {Human (Homo sapiens) [TaxId: 9606]}
gplfllpgllitchvariplpagyreeivrylrsvqlpdggwglhiedkstvfgtalnyv
slrilgvgpddpdlvrarnilhkkggavaipswgkfwlavlnvysweglntlfpemwlfp
dwapahpstlwchcrqvylpmsycyavrlsaaedplvqslrqelyvedfasidwlaqrnn
vapdelytphswllrvvyallnlyehhhsahlrqravqklyehivaddrftksisigpis
ktinmlvrwyvdgpastafqehvsripdylwmgldgmkm

SCOPe Domain Coordinates for d1w6ka2 are not available.

Timeline for d1w6ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w6ka1