Lineage for d1w6ka1 (1w6k A:6-99,A:379-732)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 541977Family a.102.4.2: Terpene synthases [48243] (2 proteins)
    consists of two toroid domains: one of six and one of five hairpins
  6. 541978Protein Lanosterol synthase [116989] (1 species)
  7. 541979Species Human (Homo sapiens) [TaxId:9606] [116990] (2 PDB entries)
  8. 541980Domain d1w6ka1: 1w6k A:6-99,A:379-732 [114271]

Details for d1w6ka1

PDB Entry: 1w6k (more details), 2.1 Å

PDB Description: structure of human osc in complex with lanosterol

SCOP Domain Sequences for d1w6ka1:

Sequence, based on SEQRES records: (download)

>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens)}
clrrrggpyktepatdlgrwrlncergrqtwtylqderagreqtgleayalgldtknyfk
dlpkahtafegalngmtfyvglqaedghwtgdygXqgtngsqiwdtafaiqalleagghh
rpefssclqkaheflrlsqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealka
vlllqekcphvtehiprerlcdavavllnmrnpdggfatyetkrgghllellnpsevfgd
imidytyvectsavmqalkyfhkrfpehraaeiretltqglefcrrqqradgswegswgv
cftygtwfgleafacmgqtyrdgtacaevsracdfllsrqmadggwgedfesceerryvq
saqsqihntcwammglmavrhpdieaqergvrcllekqlpngdwpqeniagvfnkscais
ytsyrnifpiwalgrfsqlyperalaghp

Sequence, based on observed residues (ATOM records): (download)

>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens)}
clrrrggpyktepatdlgrwrlncergrqtwtylqdagreqtgleayalgldtknyfkdl
pkahtafegalngmtfyvglqaedghwtgdygXqgtngsqiwdtafaiqalleagghhrp
efssclqkaheflrlsqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealkavl
llqekcphvtehiprerlcdavavllnmrnpdggfatyetkrgghllellnpsevfgdim
idytyvectsavmqalkyfhkrfpehraaeiretltqglefcrrqqradgswegswgvcf
tygtwfgleafacmgqtyrdgtacaevsracdfllsrqmadggwgedfesceerryvqsa
qsqihntcwammglmavrhpdieaqergvrcllekqlpngdwpqeniagvfnkscaisyt
syrnifpiwalgrfsqlyperalaghp

SCOP Domain Coordinates for d1w6ka1:

Click to download the PDB-style file with coordinates for d1w6ka1.
(The format of our PDB-style files is described here.)

Timeline for d1w6ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w6ka2