Lineage for d1w6ka1 (1w6k A:6-99,A:379-732)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004455Family a.102.4.2: Terpene synthases [48243] (2 protein domains)
    consists of two toroid domains: one of six and one of five hairpins
  6. 2004456Protein Lanosterol synthase [116989] (1 species)
  7. 2004457Species Human (Homo sapiens) [TaxId:9606] [116990] (2 PDB entries)
    Uniprot P48449
  8. 2004458Domain d1w6ka1: 1w6k A:6-99,A:379-732 [114271]
    complexed with bog, lan

Details for d1w6ka1

PDB Entry: 1w6k (more details), 2.1 Å

PDB Description: structure of human osc in complex with lanosterol
PDB Compounds: (A:) lanosterol synthase

SCOPe Domain Sequences for d1w6ka1:

Sequence, based on SEQRES records: (download)

>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]}
clrrrggpyktepatdlgrwrlncergrqtwtylqderagreqtgleayalgldtknyfk
dlpkahtafegalngmtfyvglqaedghwtgdygXqgtngsqiwdtafaiqalleagghh
rpefssclqkaheflrlsqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealka
vlllqekcphvtehiprerlcdavavllnmrnpdggfatyetkrgghllellnpsevfgd
imidytyvectsavmqalkyfhkrfpehraaeiretltqglefcrrqqradgswegswgv
cftygtwfgleafacmgqtyrdgtacaevsracdfllsrqmadggwgedfesceerryvq
saqsqihntcwammglmavrhpdieaqergvrcllekqlpngdwpqeniagvfnkscais
ytsyrnifpiwalgrfsqlyperalaghp

Sequence, based on observed residues (ATOM records): (download)

>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]}
clrrrggpyktepatdlgrwrlncergrqtwtylqdagreqtgleayalgldtknyfkdl
pkahtafegalngmtfyvglqaedghwtgdygXqgtngsqiwdtafaiqalleagghhrp
efssclqkaheflrlsqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealkavl
llqekcphvtehiprerlcdavavllnmrnpdggfatyetkrgghllellnpsevfgdim
idytyvectsavmqalkyfhkrfpehraaeiretltqglefcrrqqradgswegswgvcf
tygtwfgleafacmgqtyrdgtacaevsracdfllsrqmadggwgedfesceerryvqsa
qsqihntcwammglmavrhpdieaqergvrcllekqlpngdwpqeniagvfnkscaisyt
syrnifpiwalgrfsqlyperalaghp

SCOPe Domain Coordinates for d1w6ka1:

Click to download the PDB-style file with coordinates for d1w6ka1.
(The format of our PDB-style files is described here.)

Timeline for d1w6ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w6ka2