SCOP 1.75: Domain d1w6ja2: 1w6j A:100-378

Lineage for d1w6ja2 (1w6j A:100-378)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.2: Terpene synthases [48243] (2 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Lanosterol synthase [116989] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116990] (2 PDB entries)
   Uniprot P48449

8. Domain d1w6ja2: 1w6j A:100-378 [114270]
   complexed with bog, c14, r71

Details for d1w6ja2

PDB Entry: 1w6j, 2.2 Å

PDB Description: structure of human osc in complex with ro 48-8071

PDB Compounds: (A:) lanosterol synthase

SCOP Domain Sequences for d1w6ja2:

Sequence; same for both SEQRES and ATOM records:

>d1w6ja2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]}
gplfllpgllitchvariplpagyreeivrylrsvqlpdggwglhiedkstvfgtalnyv
slrilgvgpddpdlvrarnilhkkggavaipswgkfwlavlnvysweglntlfpemwlfp
dwapahpstlwchcrqvylpmsycyavrlsaaedplvqslrqelyvedfasidwlaqrnn
vapdelytphswllrvvyallnlyehhhsahlrqravqklyehivaddrftksisigpis
ktinmlvrwyvdgpastafqehvsripdylwmgldgmkm

Timeline for d1w6ja2:

• d1w6ja2 first appeared in SCOP 1.71
  
• d1w6ja2 appears in SCOP 1.73
  
• d1w6ja2 appears in SCOPe 2.01
  
• d1w6ja2 appears in the current release, SCOPe 2.08