Class a: All alpha proteins [46456] (226 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.2: Terpene synthases [48243] (2 proteins) consists of two toroid domains: one of six and one of five hairpins |
Protein Lanosterol synthase [116989] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116990] (2 PDB entries) |
Domain d1w6ja2: 1w6j A:100-378 [114270] complexed with bog, c14, r71 |
PDB Entry: 1w6j (more details), 2.2 Å
SCOP Domain Sequences for d1w6ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6ja2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens)} gplfllpgllitchvariplpagyreeivrylrsvqlpdggwglhiedkstvfgtalnyv slrilgvgpddpdlvrarnilhkkggavaipswgkfwlavlnvysweglntlfpemwlfp dwapahpstlwchcrqvylpmsycyavrlsaaedplvqslrqelyvedfasidwlaqrnn vapdelytphswllrvvyallnlyehhhsahlrqravqklyehivaddrftksisigpis ktinmlvrwyvdgpastafqehvsripdylwmgldgmkm
Timeline for d1w6ja2: