Lineage for d1w6ja2 (1w6j A:100-378)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 541977Family a.102.4.2: Terpene synthases [48243] (2 proteins)
    consists of two toroid domains: one of six and one of five hairpins
  6. 541978Protein Lanosterol synthase [116989] (1 species)
  7. 541979Species Human (Homo sapiens) [TaxId:9606] [116990] (2 PDB entries)
  8. 541983Domain d1w6ja2: 1w6j A:100-378 [114270]
    complexed with bog, c14, r71

Details for d1w6ja2

PDB Entry: 1w6j (more details), 2.2 Å

PDB Description: structure of human osc in complex with ro 48-8071

SCOP Domain Sequences for d1w6ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6ja2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens)}
gplfllpgllitchvariplpagyreeivrylrsvqlpdggwglhiedkstvfgtalnyv
slrilgvgpddpdlvrarnilhkkggavaipswgkfwlavlnvysweglntlfpemwlfp
dwapahpstlwchcrqvylpmsycyavrlsaaedplvqslrqelyvedfasidwlaqrnn
vapdelytphswllrvvyallnlyehhhsahlrqravqklyehivaddrftksisigpis
ktinmlvrwyvdgpastafqehvsripdylwmgldgmkm

SCOP Domain Coordinates for d1w6ja2:

Click to download the PDB-style file with coordinates for d1w6ja2.
(The format of our PDB-style files is described here.)

Timeline for d1w6ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w6ja1