Lineage for d1w6ja1 (1w6j A:6-99,A:379-732)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.2: Terpene synthases [48243] (2 proteins)
consists of two toroid domains: one of six and one of five hairpins
Protein Lanosterol synthase [116989] (1 species) Species Human (Homo sapiens) [TaxId:9606] [116990] (2 PDB entries) 
Domain d1w6ja1: 1w6j A:6-99,A:379-732 [114269]
Details for d1w6ja1
PDB Entry: 1w6j (more details), 2.2 Å
PDB Description: structure of human osc in complex with ro 48-8071
PDB Compounds: (A:) lanosterol synthaseSCOP Domain Sequences for d1w6ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6ja1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]}
clrrrggpyktepatdlgrwrlncergrqtwtylqderagreqtgleayalgldtknyfk
dlpkahtafegalngmtfyvglqaedghwtgdygXqgtngsqiwdtafaiqalleagghh
rpefssclqkaheflrlsqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealka
vlllqekcphvtehiprerlcdavavllnmrnpdggfatyetkrgghllellnpsevfgd
imidytyvectsavmqalkyfhkrfpehraaeiretltqglefcrrqqradgswegswgv
cftygtwfgleafacmgqtyrdgtacaevsracdfllsrqmadggwgedfesceerrylq
saqsqihntcwammglmavrhpdieaqergvrcllekqlpngdwpqeniagvfnkscais
ytsyrnifpiwalgrfsqlyperalaghp
SCOP Domain Coordinates for d1w6ja1:
Click to download the PDB-style file with coordinates for d1w6ja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w6ja1:
- d1w6ja1 first appeared in SCOP 1.71
- d1w6ja1 appears in SCOP 1.75
- d1w6ja1 appears in the current release, SCOPe 2.08
View in 3D
