SCOPe 2.08: Domain d1w6ja1: 1w6j A:6-99,A:379-732

Lineage for d1w6ja1 (1w6j A:6-99,A:379-732)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.2: Terpene synthases [48243] (3 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Lanosterol synthase, N- and C-terminal domain [418898] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419298] (2 PDB entries)
   Uniprot P48449

8. Domain d1w6ja1: 1w6j A:6-99,A:379-732 [114269]
   Other proteins in same PDB: d1w6ja2
   complexed with bog, c14, r71
   has additional insertions and/or extensions that are not grouped together

Details for d1w6ja1

PDB Entry: 1w6j, 2.2 Å

PDB Description: structure of human osc in complex with ro 48-8071

PDB Compounds: (A:) lanosterol synthase

SCOPe Domain Sequences for d1w6ja1:

Sequence; same for both SEQRES and ATOM records:

>d1w6ja1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
clrrrggpyktepatdlgrwrlncergrqtwtylqderagreqtgleayalgldtknyfk
dlpkahtafegalngmtfyvglqaedghwtgdygXqgtngsqiwdtafaiqalleagghh
rpefssclqkaheflrlsqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealka
vlllqekcphvtehiprerlcdavavllnmrnpdggfatyetkrgghllellnpsevfgd
imidytyvectsavmqalkyfhkrfpehraaeiretltqglefcrrqqradgswegswgv
cftygtwfgleafacmgqtyrdgtacaevsracdfllsrqmadggwgedfesceerrylq
saqsqihntcwammglmavrhpdieaqergvrcllekqlpngdwpqeniagvfnkscais
ytsyrnifpiwalgrfsqlyperalaghp

Timeline for d1w6ja1:

• d1w6ja1 first appeared in SCOP 1.71
  
• d1w6ja1 appears in SCOPe 2.07