Class a: All alpha proteins [46456] (290 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.2: Terpene synthases [48243] (3 proteins) consists of two toroid domains: one of six and one of five hairpins |
Protein Lanosterol synthase, N- and C-terminal domain [418898] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [419298] (2 PDB entries) Uniprot P48449 |
Domain d1w6ja1: 1w6j A:6-99,A:379-732 [114269] Other proteins in same PDB: d1w6ja2 complexed with bog, c14, r71 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1w6j (more details), 2.2 Å
SCOPe Domain Sequences for d1w6ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6ja1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} clrrrggpyktepatdlgrwrlncergrqtwtylqderagreqtgleayalgldtknyfk dlpkahtafegalngmtfyvglqaedghwtgdygXqgtngsqiwdtafaiqalleagghh rpefssclqkaheflrlsqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealka vlllqekcphvtehiprerlcdavavllnmrnpdggfatyetkrgghllellnpsevfgd imidytyvectsavmqalkyfhkrfpehraaeiretltqglefcrrqqradgswegswgv cftygtwfgleafacmgqtyrdgtacaevsracdfllsrqmadggwgedfesceerrylq saqsqihntcwammglmavrhpdieaqergvrcllekqlpngdwpqeniagvfnkscais ytsyrnifpiwalgrfsqlyperalaghp
Timeline for d1w6ja1: