Lineage for d1w6ba_ (1w6b A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032309Protein Neurotoxin I [57312] (1 species)
  7. 3032310Species Snake (Naja naja oxiana) [TaxId:8657] [57313] (2 PDB entries)
    Uniprot P01382
  8. 3032312Domain d1w6ba_: 1w6b A: [114268]

Details for d1w6ba_

PDB Entry: 1w6b (more details)

PDB Description: solution nmr structure of a long neurotoxin from the venom of the asian cobra, 20 structures
PDB Compounds: (A:) long neurotoxin 1

SCOPe Domain Sequences for d1w6ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6ba_ g.7.1.1 (A:) Neurotoxin I {Snake (Naja naja oxiana) [TaxId: 8657]}
itcyktpipitsetcapgqnlcytktwcdawcgsrgkvielgcaatcptvesyqdikccs
tddcnphpkqkrp

SCOPe Domain Coordinates for d1w6ba_:

Click to download the PDB-style file with coordinates for d1w6ba_.
(The format of our PDB-style files is described here.)

Timeline for d1w6ba_: