![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein CDC6-like protein APE0152, N-terminal domain [117556] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [117557] (2 PDB entries) Uniprot Q9YFU8 |
![]() | Domain d1w5tc2: 1w5t C:7-293 [114260] Other proteins in same PDB: d1w5ta1, d1w5tb1, d1w5tc1 protein/DNA complex; complexed with adp, anp, mg |
PDB Entry: 1w5t (more details), 2.4 Å
SCOPe Domain Sequences for d1w5tc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5tc2 c.37.1.20 (C:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} glfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigrvgigkt tlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrgapaldil kalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnrigfllva sdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvweprhlelis dvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavsen
Timeline for d1w5tc2:
![]() Domains from other chains: (mouse over for more information) d1w5ta1, d1w5ta2, d1w5tb1, d1w5tb2 |