Lineage for d1w5tb2 (1w5t B:7-293)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479074Protein CDC6-like protein APE0152, N-terminal domain [117556] (1 species)
  7. 2479075Species Aeropyrum pernix [TaxId:56636] [117557] (2 PDB entries)
    Uniprot Q9YFU8
  8. 2479079Domain d1w5tb2: 1w5t B:7-293 [114258]
    Other proteins in same PDB: d1w5ta1, d1w5tb1, d1w5tc1
    protein/DNA complex; complexed with adp, anp, mg

Details for d1w5tb2

PDB Entry: 1w5t (more details), 2.4 Å

PDB Description: structure of the aeropyrum pernix orc2 protein (adpnp-adp complexes)
PDB Compounds: (B:) orc2

SCOPe Domain Sequences for d1w5tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5tb2 c.37.1.20 (B:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}
glfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigrvgigkt
tlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrgapaldil
kalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnrigfllva
sdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvweprhlelis
dvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavsen

SCOPe Domain Coordinates for d1w5tb2:

Click to download the PDB-style file with coordinates for d1w5tb2.
(The format of our PDB-style files is described here.)

Timeline for d1w5tb2: