Lineage for d1w5ta1 (1w5t A:300-409)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906283Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
    follows the extended AAA-ATPase domain
  6. 906288Protein CDC6-like protein APE0152, C-terminal domain [116788] (1 species)
  7. 906289Species Aeropyrum pernix [TaxId:56636] [116789] (2 PDB entries)
    Uniprot Q9YFU8
  8. 906292Domain d1w5ta1: 1w5t A:300-409 [114255]
    Other proteins in same PDB: d1w5ta2, d1w5tb2, d1w5tc2
    protein/DNA complex; complexed with adp, anp, mg

Details for d1w5ta1

PDB Entry: 1w5t (more details), 2.4 Å

PDB Description: structure of the aeropyrum pernix orc2 protein (adpnp-adp complexes)
PDB Compounds: (A:) orc2

SCOPe Domain Sequences for d1w5ta1:

Sequence, based on SEQRES records: (download)

>d1w5ta1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl
khltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmas

Sequence, based on observed residues (ATOM records): (download)

>d1w5ta1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl
khltslglvdakpsttlfrlaphlpadrlievvdniiqakmas

SCOPe Domain Coordinates for d1w5ta1:

Click to download the PDB-style file with coordinates for d1w5ta1.
(The format of our PDB-style files is described here.)

Timeline for d1w5ta1: