SCOPe 2.05: Domain d1w5sb2: 1w5s B:7-293

Lineage for d1w5sb2 (1w5s B:7-293)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein CDC6-like protein APE0152, N-terminal domain [117556] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [117557] (2 PDB entries)
   Uniprot Q9YFU8

8. Domain d1w5sb2: 1w5s B:7-293 [114254]
   Other proteins in same PDB: d1w5sa1, d1w5sb1
   complexed with adp, so4

Details for d1w5sb2

PDB Entry: 1w5s, 2.4 Å

PDB Description: structure of the aeropyrum pernix orc2 protein (adp form)

PDB Compounds: (B:) origin recognition complex subunit 2 orc2

SCOPe Domain Sequences for d1w5sb2:

Sequence; same for both SEQRES and ATOM records:

>d1w5sb2 c.37.1.20 (B:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}
glfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigrvgigkt
tlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrgapaldil
kalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnrigfllva
sdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvweprhlelis
dvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavsen

Timeline for d1w5sb2:

• d1w5sb2 first appeared in SCOP 1.71
  
• d1w5sb2 appears in SCOPe 2.04
  
• d1w5sb2 appears in SCOPe 2.06
  
• d1w5sb2 appears in the current release, SCOPe 2.08