Lineage for d1w5sb1 (1w5s B:300-409)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693240Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
    follows the extended AAA-ATPase domain
  6. 2693245Protein CDC6-like protein APE0152, C-terminal domain [116788] (1 species)
  7. 2693246Species Aeropyrum pernix [TaxId:56636] [116789] (2 PDB entries)
    Uniprot Q9YFU8
  8. 2693248Domain d1w5sb1: 1w5s B:300-409 [114253]
    Other proteins in same PDB: d1w5sa2, d1w5sb2
    complexed with adp, so4

Details for d1w5sb1

PDB Entry: 1w5s (more details), 2.4 Å

PDB Description: structure of the aeropyrum pernix orc2 protein (adp form)
PDB Compounds: (B:) origin recognition complex subunit 2 orc2

SCOPe Domain Sequences for d1w5sb1:

Sequence, based on SEQRES records: (download)

>d1w5sb1 a.4.5.11 (B:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl
khltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmas

Sequence, based on observed residues (ATOM records): (download)

>d1w5sb1 a.4.5.11 (B:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl
khltslglvdakpsttlfrlaphlpadrlievvdniiqakmas

SCOPe Domain Coordinates for d1w5sb1:

Click to download the PDB-style file with coordinates for d1w5sb1.
(The format of our PDB-style files is described here.)

Timeline for d1w5sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w5sb2