Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins) follows the extended AAA-ATPase domain |
Protein CDC6-like protein APE0152, C-terminal domain [116788] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [116789] (2 PDB entries) Uniprot Q9YFU8 |
Domain d1w5sb1: 1w5s B:300-409 [114253] Other proteins in same PDB: d1w5sa2, d1w5sb2 complexed with adp, so4 |
PDB Entry: 1w5s (more details), 2.4 Å
SCOPe Domain Sequences for d1w5sb1:
Sequence, based on SEQRES records: (download)
>d1w5sb1 a.4.5.11 (B:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl khltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmas
>d1w5sb1 a.4.5.11 (B:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl khltslglvdakpsttlfrlaphlpadrlievvdniiqakmas
Timeline for d1w5sb1: