SCOPe 2.08: Domain d1w5sa1: 1w5s A:300-409

Lineage for d1w5sa1 (1w5s A:300-409)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
   follows the extended AAA-ATPase domain

6. Protein CDC6-like protein APE0152, C-terminal domain [116788] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [116789] (2 PDB entries)
   Uniprot Q9YFU8

8. Domain d1w5sa1: 1w5s A:300-409 [114251]
   Other proteins in same PDB: d1w5sa2, d1w5sb2
   complexed with adp, so4

Details for d1w5sa1

PDB Entry: 1w5s, 2.4 Å

PDB Description: structure of the aeropyrum pernix orc2 protein (adp form)

PDB Compounds: (A:) origin recognition complex subunit 2 orc2

SCOPe Domain Sequences for d1w5sa1:

Sequence, based on SEQRES records:

>d1w5sa1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl
khltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmas

Sequence, based on observed residues (ATOM records):

>d1w5sa1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]}
thelealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiyl
khltslglvdakpsttlfrlaphlpadrlievvdniiqakmas

Timeline for d1w5sa1:

• d1w5sa1 first appeared in SCOP 1.71
  
• d1w5sa1 appears in SCOPe 2.07