Lineage for d1w5fa2 (1w5f A:216-336)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565737Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2565808Species Thermotoga maritima [TaxId:2336] [118029] (1 PDB entry)
    Uniprot O08398 22-335
  8. 2565809Domain d1w5fa2: 1w5f A:216-336 [114248]
    Other proteins in same PDB: d1w5fa1, d1w5fb1
    complexed with g2p, mg

Details for d1w5fa2

PDB Entry: 1w5f (more details), 2 Å

PDB Description: ftsz, t7 mutated, domain swapped (t. maritima)
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d1w5fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5fa2 d.79.2.1 (A:216-336) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]}
yirltsrfariesvmkdagaailgigvgkgehrareaakkameskliehpvenassivfn
itapsnirmeevheaamiirqnssedadvkfglifddevpddeirvifiatrfpdedkil
f

SCOPe Domain Coordinates for d1w5fa2:

Click to download the PDB-style file with coordinates for d1w5fa2.
(The format of our PDB-style files is described here.)

Timeline for d1w5fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w5fa1