| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein Cell-division protein FtsZ [55309] (9 species) |
| Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries) Uniprot Q57816 23-360 |
| Domain d1w5eg2: 1w5e G:232-354 [114242] Other proteins in same PDB: d1w5ea1, d1w5eb1, d1w5ec1, d1w5ed1, d1w5ee1, d1w5ef1, d1w5eg1, d1w5eh1, d1w5ei1 complexed with gtp; mutant |
PDB Entry: 1w5e (more details), 3 Å
SCOPe Domain Sequences for d1w5eg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5eg2 d.79.2.1 (G:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtgl
krk
Timeline for d1w5eg2: