SCOP 1.71: Domain d1w5eg2: 1w5e G:232-354

Lineage for d1w5eg2 (1w5e G:232-354)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Cell-division protein FtsZ [55309] (4 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (6 PDB entries)

8. Domain d1w5eg2: 1w5e G:232-354 [114242]
   Other proteins in same PDB: d1w5ea1, d1w5eb1, d1w5ec1, d1w5ed1, d1w5ee1, d1w5ef1, d1w5eg1, d1w5eh1, d1w5ei1

Details for d1w5eg2

PDB Entry: 1w5e, 3 Å

PDB Description: ftsz w319y mutant, p1 (m. jannaschii)

SCOP Domain Sequences for d1w5eg2:

Sequence; same for both SEQRES and ATOM records:

>d1w5eg2 d.79.2.1 (G:232-354) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtgl
krk

Timeline for d1w5eg2:

• d1w5eg2 is new in SCOP 1.71
  
• d1w5eg2 appears in SCOP 1.73
  
• d1w5eg2 appears in the current release, SCOPe 2.08