![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [52492] (9 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [52493] (7 PDB entries) Uniprot Q57816 23-360 |
![]() | Domain d1w5ef1: 1w5e F:23-231 [114239] Other proteins in same PDB: d1w5ea2, d1w5eb2, d1w5ec2, d1w5ed2, d1w5ee2, d1w5ef2, d1w5eg2, d1w5eh2, d1w5ei2 complexed with gtp; mutant |
PDB Entry: 1w5e (more details), 3 Å
SCOPe Domain Sequences for d1w5ef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5ef1 c.32.1.1 (F:23-231) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]} spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm plklafkvadevlinavkglvelitkdgl
Timeline for d1w5ef1: