Lineage for d1w5ee1 (1w5e E:23-231)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580909Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 580910Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 580911Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 580912Protein Cell-division protein FtsZ [52492] (4 species)
  7. 580913Species Archaeon Methanococcus jannaschii [TaxId:2190] [52493] (6 PDB entries)
  8. 580926Domain d1w5ee1: 1w5e E:23-231 [114237]
    Other proteins in same PDB: d1w5ea2, d1w5eb2, d1w5ec2, d1w5ed2, d1w5ee2, d1w5ef2, d1w5eg2, d1w5eh2, d1w5ei2

Details for d1w5ee1

PDB Entry: 1w5e (more details), 3 Å

PDB Description: ftsz w319y mutant, p1 (m. jannaschii)

SCOP Domain Sequences for d1w5ee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5ee1 c.32.1.1 (E:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl

SCOP Domain Coordinates for d1w5ee1:

Click to download the PDB-style file with coordinates for d1w5ee1.
(The format of our PDB-style files is described here.)

Timeline for d1w5ee1: