![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
![]() | Protein Cell-division protein FtsZ [55309] (4 species) |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (6 PDB entries) |
![]() | Domain d1w5ed2: 1w5e D:232-354 [114236] Other proteins in same PDB: d1w5ea1, d1w5eb1, d1w5ec1, d1w5ed1, d1w5ee1, d1w5ef1, d1w5eg1, d1w5eh1, d1w5ei1 |
PDB Entry: 1w5e (more details), 3 Å
SCOP Domain Sequences for d1w5ed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5ed2 d.79.2.1 (D:232-354) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii} invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg pedltleearevvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtgl krk
Timeline for d1w5ed2: