Lineage for d1w5ec2 (1w5e C:232-354)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420833Protein Cell-division protein FtsZ [55309] (9 species)
  7. 1420845Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
    Uniprot Q57816 23-360
  8. 1420857Domain d1w5ec2: 1w5e C:232-354 [114234]
    Other proteins in same PDB: d1w5ea1, d1w5eb1, d1w5ec1, d1w5ed1, d1w5ee1, d1w5ef1, d1w5eg1, d1w5eh1, d1w5ei1
    complexed with gtp; mutant

Details for d1w5ec2

PDB Entry: 1w5e (more details), 3 Å

PDB Description: ftsz w319y mutant, p1 (m. jannaschii)
PDB Compounds: (C:) ftsz

SCOPe Domain Sequences for d1w5ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5ec2 d.79.2.1 (C:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtgl
krk

SCOPe Domain Coordinates for d1w5ec2:

Click to download the PDB-style file with coordinates for d1w5ec2.
(The format of our PDB-style files is described here.)

Timeline for d1w5ec2: