Lineage for d1w5eb2 (1w5e B:232-354)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606051Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 606158Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 606159Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 606160Protein Cell-division protein FtsZ [55309] (4 species)
  7. 606161Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (6 PDB entries)
  8. 606171Domain d1w5eb2: 1w5e B:232-354 [114232]
    Other proteins in same PDB: d1w5ea1, d1w5eb1, d1w5ec1, d1w5ed1, d1w5ee1, d1w5ef1, d1w5eg1, d1w5eh1, d1w5ei1

Details for d1w5eb2

PDB Entry: 1w5e (more details), 3 Å

PDB Description: ftsz w319y mutant, p1 (m. jannaschii)

SCOP Domain Sequences for d1w5eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5eb2 d.79.2.1 (B:232-354) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtgl
krk

SCOP Domain Coordinates for d1w5eb2:

Click to download the PDB-style file with coordinates for d1w5eb2.
(The format of our PDB-style files is described here.)

Timeline for d1w5eb2: