Lineage for d1w5ea1 (1w5e A:23-231)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843636Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1843648Species Methanococcus jannaschii [TaxId:2190] [52493] (7 PDB entries)
    Uniprot Q57816 23-360
  8. 1843658Domain d1w5ea1: 1w5e A:23-231 [114229]
    Other proteins in same PDB: d1w5ea2, d1w5eb2, d1w5ec2, d1w5ed2, d1w5ee2, d1w5ef2, d1w5eg2, d1w5eh2, d1w5ei2
    complexed with gtp; mutant

Details for d1w5ea1

PDB Entry: 1w5e (more details), 3 Å

PDB Description: ftsz w319y mutant, p1 (m. jannaschii)
PDB Compounds: (A:) ftsz

SCOPe Domain Sequences for d1w5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5ea1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl

SCOPe Domain Coordinates for d1w5ea1:

Click to download the PDB-style file with coordinates for d1w5ea1.
(The format of our PDB-style files is described here.)

Timeline for d1w5ea1: