| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.5: Photosystems [58155] (1 superfamily) |
Superfamily i.5.1: Photosystems [58156] (1 family) ![]() |
| Family i.5.1.1: Photosystems [58157] (5 proteins) not a true family |
| Protein Photosystem II [58160] (2 species) there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains |
| Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries) |
| Domain d1w5cj_: 1w5c J: [114224] complexed with bcr, cla, fe2, hec, hem, mn, pho, pl9 |
PDB Entry: 1w5c (more details), 3.2 Å
SCOPe Domain Sequences for d1w5cj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5cj_ i.5.1.1 (J:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgn
Timeline for d1w5cj_: