Lineage for d1w5ch_ (1w5c H:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 628143Fold i.5: Photosystems [58155] (1 superfamily)
  4. 628144Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 628145Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 628159Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 628197Species Thermosynechococcus vulcanus and Thermosynechococcus elongatus, bp-1 [82945] (2 PDB entries)
  8. 628205Domain d1w5ch_: 1w5c H: [114222]

Details for d1w5ch_

PDB Entry: 1w5c (more details), 3.2 Å

PDB Description: Photosystem II from Thermosynechococcus elongatus

SCOP Domain Sequences for d1w5ch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5ch_ i.5.1.1 (H:) Photosystem II {Thermosynechococcus vulcanus and Thermosynechococcus elongatus, bp-1}
lpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmfv
lpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdlel
frdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpva
pewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsssi
aavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleeaw
saipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpaf
fesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksyar
kaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg

SCOP Domain Coordinates for d1w5ch_:

Click to download the PDB-style file with coordinates for d1w5ch_.
(The format of our PDB-style files is described here.)

Timeline for d1w5ch_: