Lineage for d1w5cf_ (1w5c F:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044334Fold i.5: Photosystems [58155] (1 superfamily)
  4. 3044335Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 3044336Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 3044350Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 3044388Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 3044394Domain d1w5cf_: 1w5c F: [114220]
    complexed with bcr, cla, fe2, hec, hem, mn, pho, pl9

Details for d1w5cf_

PDB Entry: 1w5c (more details), 3.2 Å

PDB Description: Photosystem II from Thermosynechococcus elongatus
PDB Compounds: (F:) cytochrome b559 beta subunit

SCOPe Domain Sequences for d1w5cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5cf_ i.5.1.1 (F:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
epvsypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d1w5cf_:

Click to download the PDB-style file with coordinates for d1w5cf_.
(The format of our PDB-style files is described here.)

Timeline for d1w5cf_: