Lineage for d1w5ce_ (1w5c E:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044334Fold i.5: Photosystems [58155] (1 superfamily)
  4. 3044335Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 3044336Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 3044350Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 3044388Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 3044393Domain d1w5ce_: 1w5c E: [114219]
    complexed with bcr, cla, fe2, hec, hem, mn, pho, pl9

Details for d1w5ce_

PDB Entry: 1w5c (more details), 3.2 Å

PDB Description: Photosystem II from Thermosynechococcus elongatus
PDB Compounds: (E:) cytochrome b559 alpha subunit

SCOPe Domain Sequences for d1w5ce_:

Sequence, based on SEQRES records: (download)

>d1w5ce_ i.5.1.1 (E:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
rpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvt
drfeakqqvetfleqlk

Sequence, based on observed residues (ATOM records): (download)

>d1w5ce_ i.5.1.1 (E:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
rpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvt
drfakqqvetfleqlk

SCOPe Domain Coordinates for d1w5ce_:

Click to download the PDB-style file with coordinates for d1w5ce_.
(The format of our PDB-style files is described here.)

Timeline for d1w5ce_: