Lineage for d1w5bb2 (1w5b B:232-354)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420833Protein Cell-division protein FtsZ [55309] (9 species)
  7. 1420845Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
    Uniprot Q57816 23-360
  8. 1420848Domain d1w5bb2: 1w5b B:232-354 [114214]
    Other proteins in same PDB: d1w5ba1, d1w5bb1
    complexed with gtp

Details for d1w5bb2

PDB Entry: 1w5b (more details), 2.2 Å

PDB Description: ftsz dimer, gtp soak (m. jannaschii)
PDB Compounds: (B:) cell division protein ftsz homolog 1

SCOPe Domain Sequences for d1w5bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5bb2 d.79.2.1 (B:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krk

SCOPe Domain Coordinates for d1w5bb2:

Click to download the PDB-style file with coordinates for d1w5bb2.
(The format of our PDB-style files is described here.)

Timeline for d1w5bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w5bb1