Lineage for d1w5bb1 (1w5b B:23-231)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694479Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 694480Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 694481Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 694482Protein Cell-division protein FtsZ [52492] (4 species)
  7. 694483Species Archaeon Methanococcus jannaschii [TaxId:2190] [52493] (6 PDB entries)
  8. 694485Domain d1w5bb1: 1w5b B:23-231 [114213]
    Other proteins in same PDB: d1w5ba2, d1w5bb2
    complexed with gtp

Details for d1w5bb1

PDB Entry: 1w5b (more details), 2.2 Å

PDB Description: ftsz dimer, gtp soak (m. jannaschii)
PDB Compounds: (B:) cell division protein ftsz homolog 1

SCOP Domain Sequences for d1w5bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5bb1 c.32.1.1 (B:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl

SCOP Domain Coordinates for d1w5bb1:

Click to download the PDB-style file with coordinates for d1w5bb1.
(The format of our PDB-style files is described here.)

Timeline for d1w5bb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w5bb2