Lineage for d1w5ab2 (1w5a B:232-354)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727435Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 727436Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 727437Protein Cell-division protein FtsZ [55309] (4 species)
  7. 727438Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (6 PDB entries)
  8. 727442Domain d1w5ab2: 1w5a B:232-354 [114210]
    Other proteins in same PDB: d1w5aa1, d1w5ab1
    complexed with gtp, mg

Details for d1w5ab2

PDB Entry: 1w5a (more details), 2.4 Å

PDB Description: ftsz dimer, mggtp soak (m. jannaschii)
PDB Compounds: (B:) cell division protein ftsz homolog 1

SCOP Domain Sequences for d1w5ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5ab2 d.79.2.1 (B:232-354) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krk

SCOP Domain Coordinates for d1w5ab2:

Click to download the PDB-style file with coordinates for d1w5ab2.
(The format of our PDB-style files is described here.)

Timeline for d1w5ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w5ab1