SCOPe 2.08: Domain d1w5ab2: 1w5a B:232-354

Lineage for d1w5ab2 (1w5a B:232-354)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
   Uniprot Q57816 23-360

8. Domain d1w5ab2: 1w5a B:232-354 [114210]
   Other proteins in same PDB: d1w5aa1, d1w5ab1
   complexed with gtp, mg
   missing some secondary structures that made up less than one-third of the common domain

Details for d1w5ab2

PDB Entry: 1w5a, 2.4 Å

PDB Description: ftsz dimer, mggtp soak (m. jannaschii)

PDB Compounds: (B:) cell division protein ftsz homolog 1

SCOPe Domain Sequences for d1w5ab2:

Sequence; same for both SEQRES and ATOM records:

>d1w5ab2 d.79.2.1 (B:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krk

Timeline for d1w5ab2:

• d1w5ab2 first appeared in SCOP 1.71
  
• d1w5ab2 appears in SCOPe 2.07