![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) ![]() |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins) |
![]() | Protein Cell-division protein FtsZ [52492] (4 species) |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [52493] (6 PDB entries) |
![]() | Domain d1w5ab1: 1w5a B:23-231 [114209] Other proteins in same PDB: d1w5aa2, d1w5ab2 complexed with gtp, mg |
PDB Entry: 1w5a (more details), 2.4 Å
SCOP Domain Sequences for d1w5ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5ab1 c.32.1.1 (B:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii} spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm plklafkvadevlinavkglvelitkdgl
Timeline for d1w5ab1: