Lineage for d1w5aa2 (1w5a A:232-354)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606051Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 606158Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 606159Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 606160Protein Cell-division protein FtsZ [55309] (4 species)
  7. 606161Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (6 PDB entries)
  8. 606164Domain d1w5aa2: 1w5a A:232-354 [114208]
    Other proteins in same PDB: d1w5aa1, d1w5ab1

Details for d1w5aa2

PDB Entry: 1w5a (more details), 2.4 Å

PDB Description: ftsz dimer, mggtp soak (m. jannaschii)

SCOP Domain Sequences for d1w5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5aa2 d.79.2.1 (A:232-354) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krk

SCOP Domain Coordinates for d1w5aa2:

Click to download the PDB-style file with coordinates for d1w5aa2.
(The format of our PDB-style files is described here.)

Timeline for d1w5aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w5aa1