![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [55309] (9 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries) Uniprot Q57816 23-360 |
![]() | Domain d1w5aa2: 1w5a A:232-354 [114208] Other proteins in same PDB: d1w5aa1, d1w5ab1 complexed with gtp, mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1w5a (more details), 2.4 Å
SCOPe Domain Sequences for d1w5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5aa2 d.79.2.1 (A:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]} invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl krk
Timeline for d1w5aa2: