Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries) Uniprot Q57816 23-360 |
Domain d1w59b2: 1w59 B:232-354 [114206] Other proteins in same PDB: d1w59a1, d1w59b1 complexed with so4 |
PDB Entry: 1w59 (more details), 2.7 Å
SCOPe Domain Sequences for d1w59b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w59b2 d.79.2.1 (B:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]} invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl krk
Timeline for d1w59b2: