SCOP 1.75: Domain d1w59b2: 1w59 B:232-354

Lineage for d1w59b2 (1w59 B:232-354)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Cell-division protein FtsZ [55309] (4 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
   Uniprot Q57816 23-360

8. Domain d1w59b2: 1w59 B:232-354 [114206]
   Other proteins in same PDB: d1w59a1, d1w59b1
   complexed with so4

Details for d1w59b2

PDB Entry: 1w59, 2.7 Å

PDB Description: ftsz dimer, empty (m. jannaschii)

PDB Compounds: (B:) cell division protein ftsz homolog 1

SCOP Domain Sequences for d1w59b2:

Sequence; same for both SEQRES and ATOM records:

>d1w59b2 d.79.2.1 (B:232-354) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krk

Timeline for d1w59b2:

• d1w59b2 first appeared in SCOP 1.71
  
• d1w59b2 appears in SCOP 1.73
  
• d1w59b2 appears in SCOPe 2.01
  
• d1w59b2 appears in the current release, SCOPe 2.08