Lineage for d1w59b1 (1w59 B:23-231)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863169Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2863181Species Methanococcus jannaschii [TaxId:2190] [52493] (7 PDB entries)
    Uniprot Q57816 23-360
  8. 2863190Domain d1w59b1: 1w59 B:23-231 [114205]
    Other proteins in same PDB: d1w59a2, d1w59b2
    complexed with so4

Details for d1w59b1

PDB Entry: 1w59 (more details), 2.7 Å

PDB Description: ftsz dimer, empty (m. jannaschii)
PDB Compounds: (B:) cell division protein ftsz homolog 1

SCOPe Domain Sequences for d1w59b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w59b1 c.32.1.1 (B:23-231) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl

SCOPe Domain Coordinates for d1w59b1:

Click to download the PDB-style file with coordinates for d1w59b1.
(The format of our PDB-style files is described here.)

Timeline for d1w59b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w59b2