Lineage for d1w59a2 (1w59 A:232-354)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032295Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 1032296Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 1032297Protein Cell-division protein FtsZ [55309] (4 species)
  7. 1032298Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
    Uniprot Q57816 23-360
  8. 1032305Domain d1w59a2: 1w59 A:232-354 [114204]
    Other proteins in same PDB: d1w59a1, d1w59b1
    complexed with so4

Details for d1w59a2

PDB Entry: 1w59 (more details), 2.7 Å

PDB Description: ftsz dimer, empty (m. jannaschii)
PDB Compounds: (A:) cell division protein ftsz homolog 1

SCOPe Domain Sequences for d1w59a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w59a2 d.79.2.1 (A:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krk

SCOPe Domain Coordinates for d1w59a2:

Click to download the PDB-style file with coordinates for d1w59a2.
(The format of our PDB-style files is described here.)

Timeline for d1w59a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w59a1