SCOP 1.75: Domain d1w59a1: 1w59 A:23-231

Lineage for d1w59a1 (1w59 A:23-231)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)

6. Protein Cell-division protein FtsZ [52492] (4 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [52493] (7 PDB entries)
   Uniprot Q57816 23-360

8. Domain d1w59a1: 1w59 A:23-231 [114203]
   Other proteins in same PDB: d1w59a2, d1w59b2

Details for d1w59a1

PDB Entry: 1w59, 2.7 Å

PDB Description: ftsz dimer, empty (m. jannaschii)

PDB Compounds: (A:) cell division protein ftsz homolog 1

SCOP Domain Sequences for d1w59a1:

Sequence; same for both SEQRES and ATOM records:

>d1w59a1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl

Timeline for d1w59a1:

• d1w59a1 first appeared in SCOP 1.71
  
• d1w59a1 appears in SCOP 1.73
  
• d1w59a1 appears in SCOPe 2.01
  
• d1w59a1 appears in the current release, SCOPe 2.08