Lineage for d1w5812 (1w58 1:232-354)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565737Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2565749Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
    Uniprot Q57816 23-360
  8. 2565755Domain d1w5812: 1w58 1:232-354 [114202]
    Other proteins in same PDB: d1w5811
    complexed with g2p, mg

Details for d1w5812

PDB Entry: 1w58 (more details), 2.5 Å

PDB Description: ftsz gmpcpp soak i213 (m. jannaschii)
PDB Compounds: (1:) cell division protein ftsz homolog 1

SCOPe Domain Sequences for d1w5812:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w5812 d.79.2.1 (1:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krk

SCOPe Domain Coordinates for d1w5812:

Click to download the PDB-style file with coordinates for d1w5812.
(The format of our PDB-style files is described here.)

Timeline for d1w5812:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w5811