Lineage for d1w5812 (1w58 1:232-354)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) Protein Cell-division protein FtsZ [55309] (9 species) 
Species Methanococcus jannaschii [TaxId:2190] [55310] (7 PDB entries)
Uniprot Q57816 23-360
Domain d1w5812: 1w58 1:232-354 [114202]
Other proteins in same PDB: d1w5811
complexed with g2p, mg
missing some secondary structures that made up less than one-third of the common domain
Details for d1w5812
PDB Entry: 1w58 (more details), 2.5 Å
PDB Description: ftsz gmpcpp soak i213 (m. jannaschii)
PDB Compounds: (1:) cell division protein ftsz homolog 1SCOPe Domain Sequences for d1w5812:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5812 d.79.2.1 (1:232-354) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
invdfadvkavmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmg
pedltleearevvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtgl
krk
SCOPe Domain Coordinates for d1w5812:
Click to download the PDB-style file with coordinates for d1w5812.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w5812:
- d1w5812 first appeared in SCOP 1.71
- d1w5812 appears in SCOPe 2.07
View in 3D
