| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein Cell-division protein FtsZ [52492] (9 species) |
| Species Methanococcus jannaschii [TaxId:2190] [52493] (7 PDB entries) Uniprot Q57816 23-360 |
| Domain d1w5811: 1w58 1:23-231 [114201] Other proteins in same PDB: d1w5812 complexed with g2p, mg |
PDB Entry: 1w58 (more details), 2.5 Å
SCOPe Domain Sequences for d1w5811:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5811 c.32.1.1 (1:23-231) Cell-division protein FtsZ {Methanococcus jannaschii [TaxId: 2190]}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl
Timeline for d1w5811: