Lineage for d1w5811 (1w58 1:23-231)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) 
Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins) Protein Cell-division protein FtsZ [52492] (4 species) 
Species Archaeon Methanococcus jannaschii [TaxId:2190] [52493] (6 PDB entries) 
Domain d1w5811: 1w58 1:23-231 [114201]
Other proteins in same PDB: d1w5812
complexed with g2p, mg
Details for d1w5811
PDB Entry: 1w58 (more details), 2.5 Å
PDB Description: ftsz gmpcpp soak i213 (m. jannaschii)
SCOP Domain Sequences for d1w5811:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w5811 c.32.1.1 (1:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii}
spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
plklafkvadevlinavkglvelitkdgl
SCOP Domain Coordinates for d1w5811:
Click to download the PDB-style file with coordinates for d1w5811.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w5811:
- d1w5811 is new in SCOP 1.71
- d1w5811 appears in SCOP 1.73
- d1w5811 appears in the current release, SCOPe 2.08
View in 3D
