![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (1 family) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.1: IpsF-like [69766] (2 proteins) |
![]() | Protein IspD/ispF bifunctional enzyme, MECDP synthase domain [118027] (1 species) |
![]() | Species Campylobacter jejuni [TaxId:197] [118028] (2 PDB entries) |
![]() | Domain d1w57a2: 1w57 A:208-370 [114200] Other proteins in same PDB: d1w57a1 complexed with c, gpp, zn |
PDB Entry: 1w57 (more details), 3.09 Å
SCOP Domain Sequences for d1w57a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w57a2 d.79.5.1 (A:208-370) IspD/ispF bifunctional enzyme, MECDP synthase domain {Campylobacter jejuni} feiftgngfdvhefgenrplllagvqihptmglkahsdgdvlahsltdailgaaglgdig elypdtdmkfknansmellkqaydkvreigfelinidicvmaqspklkdfkqamqsniah tldldefrinvkattteklgfigrkegmavlssvnlkyfdwtr
Timeline for d1w57a2: