Lineage for d1w57a2 (1w57 A:208-370)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2526105Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2526106Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2526200Protein IspD/ispF bifunctional enzyme, MECDP synthase domain [118027] (1 species)
  7. 2526201Species Campylobacter jejuni [TaxId:197] [118028] (2 PDB entries)
    Uniprot Q9PM68
  8. 2526203Domain d1w57a2: 1w57 A:208-370 [114200]
    Other proteins in same PDB: d1w57a1
    complexed with c5p, gpp, zn

Details for d1w57a2

PDB Entry: 1w57 (more details), 3.09 Å

PDB Description: structure of the bifunctional ispdf from campylobacter jejuni containing zn
PDB Compounds: (A:) ispd/ispf bifunctional enzyme

SCOPe Domain Sequences for d1w57a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w57a2 d.79.5.1 (A:208-370) IspD/ispF bifunctional enzyme, MECDP synthase domain {Campylobacter jejuni [TaxId: 197]}
feiftgngfdvhefgenrplllagvqihptmglkahsdgdvlahsltdailgaaglgdig
elypdtdmkfknansmellkqaydkvreigfelinidicvmaqspklkdfkqamqsniah
tldldefrinvkattteklgfigrkegmavlssvnlkyfdwtr

SCOPe Domain Coordinates for d1w57a2:

Click to download the PDB-style file with coordinates for d1w57a2.
(The format of our PDB-style files is described here.)

Timeline for d1w57a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w57a1