Lineage for d1w57a1 (1w57 A:3-207)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2899081Protein IspD/IspF bifunctional enzyme, CDP-me synthase domain [117700] (1 species)
  7. 2899082Species Campylobacter jejuni [TaxId:197] [117701] (2 PDB entries)
    Uniprot Q9PM68
  8. 2899084Domain d1w57a1: 1w57 A:3-207 [114199]
    Other proteins in same PDB: d1w57a2
    complexed with c5p, gpp, zn

Details for d1w57a1

PDB Entry: 1w57 (more details), 3.09 Å

PDB Description: structure of the bifunctional ispdf from campylobacter jejuni containing zn
PDB Compounds: (A:) ispd/ispf bifunctional enzyme

SCOPe Domain Sequences for d1w57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w57a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]}
emslimlaagnstrfntkvkkqflrlgndplwlyatknlssfypfkkivvtssnitymkk
ftknyefieggdtraeslkkalelidsefvmvsdvarvlvsknlfdrlienldkadcitp
alkvadttlfdnealqrekikliqtpqisktkllkkaldqnleftddstaiaamggkiwf
vegeenarkltfkedlkkldlptps

SCOPe Domain Coordinates for d1w57a1:

Click to download the PDB-style file with coordinates for d1w57a1.
(The format of our PDB-style files is described here.)

Timeline for d1w57a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w57a2