![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
![]() | Protein IspD/IspF bifunctional enzyme, CDP-me synthase domain [117700] (1 species) |
![]() | Species Campylobacter jejuni [TaxId:197] [117701] (2 PDB entries) Uniprot Q9PM68 |
![]() | Domain d1w57a1: 1w57 A:3-207 [114199] Other proteins in same PDB: d1w57a2 complexed with c5p, gpp, zn |
PDB Entry: 1w57 (more details), 3.09 Å
SCOPe Domain Sequences for d1w57a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w57a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} emslimlaagnstrfntkvkkqflrlgndplwlyatknlssfypfkkivvtssnitymkk ftknyefieggdtraeslkkalelidsefvmvsdvarvlvsknlfdrlienldkadcitp alkvadttlfdnealqrekikliqtpqisktkllkkaldqnleftddstaiaamggkiwf vegeenarkltfkedlkkldlptps
Timeline for d1w57a1: