Lineage for d1w55a1 (1w55 A:3-207)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589782Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 589783Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (14 families) (S)
  5. 590036Family c.68.1.13: Cytidylytransferase [68901] (6 proteins)
  6. 590111Protein IspD/IspF bifunctional enzyme, CDP-me synthase domain [117700] (1 species)
  7. 590112Species Campylobacter jejuni [TaxId:197] [117701] (2 PDB entries)
  8. 590113Domain d1w55a1: 1w55 A:3-207 [114197]
    Other proteins in same PDB: d1w55a2
    complexed with c, edo, gpp, mg

Details for d1w55a1

PDB Entry: 1w55 (more details), 2.3 Å

PDB Description: structure of the bifunctional ispdf from campylobacter jejuni

SCOP Domain Sequences for d1w55a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni}
emslimlaagnstrfntkvkkqflrlgndplwlyatknlssfypfkkivvtssnitymkk
ftknyefieggdtraeslkkalelidsefvmvsdvarvlvsknlfdrlienldkadcitp
alkvadttlfdnealqrekikliqtpqisktkllkkaldqnleftddstaiaamggkiwf
vegeenarkltfkedlkkldlptps

SCOP Domain Coordinates for d1w55a1:

Click to download the PDB-style file with coordinates for d1w55a1.
(The format of our PDB-style files is described here.)

Timeline for d1w55a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w55a2