SCOPe 2.05: Domain d1w4za_: 1w4z A:

Lineage for d1w4za_ (1w4z A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein beta-keto acyl carrier protein reductase [51788] (8 species)

7. Species Streptomyces coelicolor [TaxId:1902] [117408] (8 PDB entries)
   Uniprot P16544 #SP

8. Domain d1w4za_: 1w4z A: [114195]
   complexed with fmt, nap

Details for d1w4za_

PDB Entry: 1w4z, 2.5 Å

PDB Description: structure of actinorhodin polyketide (actiii) reductase

PDB Compounds: (A:) ketoacyl reductase

SCOPe Domain Sequences for d1w4za_:

Sequence; same for both SEQRES and ATOM records:

>d1w4za_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
tqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtc
dvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvt
kqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitv
navcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligp
gaaavtaqalnvcgglgny

Timeline for d1w4za_:

• d1w4za_ first appeared in SCOP 1.71
  
• d1w4za_ appears in SCOPe 2.04
  
• d1w4za_ appears in SCOPe 2.06
  
• d1w4za_ appears in the current release, SCOPe 2.08