SCOPe 2.05: Domain d1w4ua_: 1w4u A:

Lineage for d1w4ua_ (1w4u A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (14 PDB entries)
   Uniprot P62837
   E2-17 kDa 2

8. Domain d1w4ua_: 1w4u A: [114194]

Details for d1w4ua_

PDB Entry: 1w4u

PDB Description: nmr solution structure of the ubiquitin conjugating enzyme ubch5b

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-17 kda 2

SCOPe Domain Sequences for d1w4ua_:

Sequence; same for both SEQRES and ATOM records:

>d1w4ua_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d1w4ua_:

• d1w4ua_ first appeared in SCOP 1.71
  
• d1w4ua_ appears in SCOPe 2.04
  
• d1w4ua_ appears in SCOPe 2.06
  
• d1w4ua_ appears in the current release, SCOPe 2.08